Login Form






Lost Password?
No account yet? Register

Syndicate

Newsflash

 Politics of hate, submit and bad mother. In contrast to her former husband, father of the family sample. And what is the truth about the model's Jordan? Certainly more complicated than appearances. Katie Price is a person entering the extreme to extreme and full of contradictions. Model, which is appearing under the pseudonym Jordan has made millions for their beauty, says he wants love, not sex. This ruthless businesswoman who came to everything on his own, he confesses that he is hungry of love and warmth. It seems hard, but it is clearly only an illusion, what armor built to hide the fragile Katie, again and again wounded by life and people.
 
FireBoard
Welcome, Guest
Please Login or Register.    Lost Password?
cytomegalovirus Human cytomegalovirus major immediate-early protein gene, 5' end. (1 viewing) (1) Guests
Go to bottom Post Reply Favoured: 0
TOPIC: cytomegalovirus Human cytomegalovirus major immediate-early protein gene, 5' end.
#28624
genbank-updates (Visitor)
Click here to see the profile of this user
Birthdate:
cytomegalovirus Human cytomegalovirus major immediate-early protein gene, 5' end.  
LOCUS       HS5MIEP      2361 bp ds-DNA             VRL       19-MAY-1992 DEFINITION  Human cytomegalovirus major immediate-early protein gene, 5' end. ACCESSION   M60321 KEYWORDS    immediate-early protein. SOURCE      Human cytomegalovirus DNA.   ORGANISM  Human cytomegalovirus             Viridae; ds-DNA enveloped viruses; Herpesviridae;             Betaherpesvirinae. REFERENCE   1  (_base_s 1 to 2361)   AUTHORS   Chapman,B.S., Thayer,R.M., Vincent,K.A. and Haigwood,N.L.   _title_     Effect of intron A from human cytomegalovirus (Towne) immediate             early gene on heterologous _expression_ in mammalian cells   JOURNAL   Nucleic Acids Res. 19, 3937-3986 (1991)   STANDARD  full staff_entry FEATURES             Location/Qualifiers      mRNA            join(1144..1264,2089..2176,2289..2361)      CDS             join(2106..2176,2289..2361)                      /note= 68-72 kDa major immediate-early protein                      /codon_start=1                      /translation= MESSAKRKMDPDNPDEGPSSKVPRPETPVTKATTFLQTMLRKEV                      NSQL                      /partial      repeat_unit     119..148                      /rpt_family= inverted repeat      repeat_unit     183..211                      /rpt_family= inverted repeat      misc_binding    371..385                      /note= NF1 binding site      misc_binding    415..429                      /note= NF1 binding site      misc_binding    462..476                      /note= NF1 binding site      misc_binding    516..530                      /note= NF1 binding site      enhancer        534..1081      conflict        653      conflict        655      conflict        665      conflict        678      conflict        691      conflict        807      conflict        846      conflict        877      CAAT_signal     1082..1086      TATA_signal     1115..1120      conflict        1121      exon            1144..1264                      /number=1      intron          1265..2088                      /number=1      misc_binding    1487..1501                      /note= NF1 binding site      exon            2089..2176                      /number=2      intron          2177..2288                      /number=2      exon            2289..2361                      /number=3 _base_ COUNT      571 a    567 c    574 g    649 t ORIGIN         1 ctgcagtgaa taataaaatg tgtgtttgtc cgaaatacgc gttttgagat ttctgtcgcc        61 gactaaattc atgtcgcgcg atagtggtgt ttatcgccga tagagatggc gatattggaa       121 aaatcgatat ttgaaaatat ggcatattga aaatgtcgcc gatgtgagtt tctgtgtaac       181 tgatatcgcc atttttccaa aagtgatttt tgggcatacg cgatatctgg cgatacggct       241 tatatcgttt acgggggatg gcgatagacg actttggcga cttgggcgat tctgtgtgtc       301 gcaaatatcg cagtttcgat ataggtgaca gacgatatga ggctatatcg ccgatagagg       361 cgacatcaag ctggcacatg gccaatgcat atcgatctat acattgaatc aatattggca       421 attagccata ttagtcattg gttatatagc ataaatcaat attggctatt ggccattgca       481 tacgttgtat ctatatcata atatgtacat ttatattggc tcatgtccaa tatgaccgcc       541 atgttgacat tgattattga ctagttatta atagtaatca attacggggt cattagttca       601 tagcccatat atggagttcc gcgttacata acttacggta aatggcccgc ctcgtgaccg       661 cccaacgacc cccgcccatt gacgtcaata atgacgtatg ttcccatagt aacgccaata       721 gggactttcc attgacgtca atgggtggag tatttacggt aaactgccca cttggcagta       781 catcaagtgt atcatatgcc aagtccggcc ccctattgac gtcaatgacg gtaaatggcc       841 cgcctggcat tatgcccagt acatgacctt acgggacttt cctacttggc agtacatcta       901 cgtattagtc atcgctatta ccatggtgat gcggttttgg cagtacacca atgggcgtgg       961 atagcggttt gactcacggg gatttccaag tctccacccc attgacgtca atgggagttt      1021 gttttggcac caaaatcaac gggactttcc aaaatgtcgt aataaccccg ccccgttgac      1081 gcaaatgggc ggtaggcgtg tacggtggga ggtctatata agcagagctc gtttagtgaa      1141 ccgtcagatc gcctggagac gccatccacg ctgttttgac ctccatagaa gacaccggga      1201 ccgatccagc ctccgcggcc gggaacggtg cattggaacg cggattcccc gtgccaagag      1261 tgacgtaagt accgcctata gactctatag gcacacccct ttggctctta tgcatgctat      1321 actgtttttg gcttggggcc tatacacccc cgctccttat gctataggtg atggtatagc      1381 ttagcctata ggtgtgggtt attgaccatt attgaccact cccctattgg tgacgatact      1441 ttccattact aatccataac atggctcttt gccacaacta tctctattgg ctatatgcca      1501 atactctgtc cttcagagac tgacacggac tctgtatttt tacaggatgg ggtcccattt      1561 attatttaca aattcacata tacaacaacg ccgtcccccg tgcccgcagt ttttattaaa      1621 catagcgtgg gatctccacg cgaatctcgg gtacgtgttc cggacatggg ctcttctccg      1681 gtagcggcgg agcttccaca tccgagccct ggtcccatgc ctccagcggc tcatggtcgc      1741 tcggcagctc cttgctccta acagtggagg ccagacttag gcacagcaca atgcccacca      1801 ccaccagtgt gccgcacaag gccgtggcgg tagggtatgt gtctgaaaat gagctcggag      1861 attgggctcg caccgtgacg cagatggaag acttaaggca gcggcagaag aagatgcagg      1921 cagctgagtt gttgtattct gataagagtc agaggtaact cccgttgcgg tgctgttaac      1981 ggtggagggc agtgtagtct gagcagtact cgttgctgcc gcgcgcgcca ccagacataa      2041 tagctgacag actaacagac tgttcctttc catgggtctt ttctgcagtc accgtccttg      2101 acacgatgga gtcctctgcc aagagaaaga tggaccctga taatcctgac gagggccctt      2161 cctccaaggt gccacggtac gtgtcggggt ttgtgccccc cctttttttt ataaaattgt      2221 attaatgtta tatacatatc tcctgtatgt gacccatgtg cttatgactc tatttctcat      2281 gtgtttaggc ccgagacacc cgtgaccaag gccacgacgt tcctgcagac tatgttgagg      2341 aaggaggtta acagtcagct g //
 
Report to moderator   Logged Logged  
  The administrator has disabled public write access.
      Topics Author Date
    thread link
cytomegalovirus Human cytomegalovirus major immediate-early protein gene, 5' end.
genbank-updates 2009/10/09 15:37
Go to top Post Reply
Powered by FireBoardget the latest posts directly to your desktop

Who's Online

We have 79 guests online

Fred Dust - divorced after 2 month of marriage

And it all could be so beautifu... coolcarsblog.co.uk erotic motor.world-auto.co.uk lA little over two months ago, lucky singer Limp Bizkit, Fred Durst, announced to the world on a blog that he married his girlfriend, Esther Nazarov. Relationship had to be perfect, couple well-chosen and proven over the years. Unfortunately, only a few weeks after the intimate ceremony in Las Vegas Durst once wrote in an online diary: I would like to Furniture products used cars Buy food online inform all concerned that Esther and I decided that it was time to go separate ways in life. Thank you to everyone who supported us. I am grateful for the support and warm words. Very. I can also say that they both hold up well and parting culturally, in a positive atmosphere.

Pamela Anderson: I'm not a bancrupt!

A few days ago we wrote silencer carfinance-offers.co.uk apartment rental about the debt, which has caused the Pamela Anderson, as every year, changing the decor of his house. The owner of the famous zgranulowanych breast wished costly and sophisticated alterations, and when the contractor sent its bill Ceased to answer calls. Currently, debt is more than 1.2 million dollars, but Pam travel and money site Cars Denver Real Estate insists that ... There are no debts. I am completely financially stable, and I thank all those who contested the recent media reports - wrote in a statement issued yesterday Anderson. It is true that I am still in the course of discussions with some of the subcontractors working on my house. But that's because after paying millions of dollars for its construction still get a wrong call for payment of accounts. My lawyers check out how the work furniture.blogsboom.com Car reviews apartment home guide has been done and whether professionals actually have the right to require such enormous sums. Where appropriate, it will pay, if not - it does not. I am only sorry that one of the performers went with the whole affair to the press.